Purification, conformational analysis and cytotoxic activities of host-defense peptides from the Tungara frog Engystomops pustulosus (Leptodactylidae; Leiuperinae).


Journal

Amino acids
ISSN: 1438-2199
Titre abrégé: Amino Acids
Pays: Austria
ID NLM: 9200312

Informations de publication

Date de publication:
Oct 2023
Historique:
received: 22 04 2023
accepted: 01 08 2023
medline: 4 12 2023
pubmed: 7 8 2023
entrez: 7 8 2023
Statut: ppublish

Résumé

The amphibian family Leptodactylidae is divided into three sub-families: Leiuperinae, Leptodactylinae, and Paratelmatobiinae. Host-defense peptides (HDPs) present in the skins of frogs belonging to the Leptodactylinae have been studied extensively, but information is limited  regarding peptides from Leiuperinae species. Peptidomic analysis of norepinephrine-stimulated skin secretions from the Tungara frog Engystomops pustulosus (Leiuperinae) collected in Trinidad led to the isolation and structural characterization of previously undescribed pustulosin-1 (FWKADVKEIG KKLAAKLAEELAKKLGEQ), [Q28E] pustulosin-1 (pustulosin-2), and pustulosin-3 (DWKETAKELLKKIGAKVAQVISDKLNPAPQ). The primary structures of these peptides do not resemble those of previously described frog skin HDPs. In addition, the secretions contained tigerinin-1EP (GCKTYLIEPPVCT) with structural similarity to the tigerinins previously identified in skin secretions from frogs from the family Dicroglossidae. Pustulosin-1 and -3 adopted extended α-helical conformations in 25% trifluoroethanol-water and in the presence of cell membrane models (sodium dodecylsulfate and dodecylphosphocholine micelles). Pustulosin-1 and -3 displayed cytotoxic activity against a range of human tumor-derived cell lines (A549, MDA-MB-231, and HT29), but their therapeutic potential for development into anti-cancer agents is limited by their comparable cytotoxic activity against non-neoplastic human umbilical vein endothelial cells. The peptides also displayed weak antimicrobial activity against Escherichia coli (MIC = 125 µM) but were inactive against Staphylococcus aureus. Tigerinin-1EP was inactive against both the tumor-derived cells and bacteria.

Identifiants

pubmed: 37548712
doi: 10.1007/s00726-023-03312-2
pii: 10.1007/s00726-023-03312-2
pmc: PMC10689532
doi:

Substances chimiques

Antimicrobial Cationic Peptides 0
Amphibian Proteins 0
Antineoplastic Agents 0

Types de publication

Journal Article

Langues

eng

Sous-ensembles de citation

IM

Pagination

1349-1359

Subventions

Organisme : Labex SynOrg
ID : ANR-11-LABX-0029
Organisme : Carnot institute
ID : 12C
Organisme : UWI Campus Research and Publication Fund
ID : CRP.3.NOV16.8(1)

Informations de copyright

© 2023. The Author(s).

Références

J Nat Prod. 2015 Dec 24;78(12):3041-8
pubmed: 26606380
J Pept Sci. 2023 Apr;29(4):e3463
pubmed: 36426386
Peptides. 2018 May;103:72-83
pubmed: 29596881
J Biol Chem. 2001 Jan 26;276(4):2701-7
pubmed: 11031261
Toxicon. 2009 Jul;54(1):23-32
pubmed: 19298834
Front Immunol. 2019 Jan 14;9:3128
pubmed: 30692997
Anal Biochem. 1993 Feb 15;209(1):32-44
pubmed: 8465960
Biochemistry. 1981 Jan 6;20(1):33-7
pubmed: 7470476
Peptides. 2009 Jul;30(7):1228-32
pubmed: 19540421
Antibiotics (Basel). 2020 Oct 29;9(11):
pubmed: 33138046
Peptides. 2005 Apr;26(4):597-601
pubmed: 15752573
Biopolymers. 2008 May;89(5):392-400
pubmed: 17896349
Biochemistry. 2013 Oct 15;52(41):7231-41
pubmed: 24073891
Annu Rev Microbiol. 2017 Sep 8;71:519-538
pubmed: 28697671
J Pept Sci. 2019 Apr;25(4):e3153
pubmed: 30734396
Proteins. 2017 Nov;85(11):1975-1982
pubmed: 28707342
Toxicon. 2007 Dec 15;50(8):1095-104
pubmed: 17884127
Regul Pept. 2014 Nov;194-195:69-76
pubmed: 25447194
Bioinformatics. 2008 Sep 15;24(18):2101-2
pubmed: 18662927
Peptides. 2008 Sep;29(9):1631-2
pubmed: 18539359
Protein Sci. 1999 Feb;8(2):370-80
pubmed: 10048330
Proc Biol Sci. 2009 May 22;276(1663):1787-95
pubmed: 19324764
Curr Protein Pept Sci. 2017;18(12):1263-1272
pubmed: 28699512
Nucleic Acids Res. 2016 Jan 4;44(D1):D1087-93
pubmed: 26602694
R Soc Open Sci. 2021 Sep 8;8(9):210048
pubmed: 34527266
PLoS One. 2016 May 13;11(5):e0155745
pubmed: 27176629
Methods Mol Biol. 2018;1719:319-333
pubmed: 29476521
Protein Sci. 2022 Jan;31(1):37-46
pubmed: 34216059
J Nat Prod. 2020 Apr 24;83(4):972-984
pubmed: 32134261
Nat Commun. 2017 Nov 14;8(1):1495
pubmed: 29138448
Biochimie. 2014 Jun;101:83-92
pubmed: 24412102
Anal Biochem. 1990 Nov 15;191(1):110-8
pubmed: 2077933
Proc Natl Acad Sci U S A. 1993 Feb 1;90(3):838-42
pubmed: 8430094
Biophys J. 1967 Mar;7(2):121-35
pubmed: 6048867
Mol Ecol. 2005 Oct;14(12):3857-76
pubmed: 16202101
J Nat Prod. 2016 Sep 23;79(9):2350-6
pubmed: 27560386
Diabetes Obes Metab. 2011 Dec;13(12):1114-22
pubmed: 21736689
Arch Biochem Biophys. 1964 Nov;108:341-8
pubmed: 14240587
Environ Sci Pollut Res Int. 2022 Jun;29(26):40262-40272
pubmed: 35461421
Expert Rev Proteomics. 2019 Nov - Dec;16(11-12):897-908
pubmed: 31729236
Gene. 2017 Mar 20;605:70-80
pubmed: 28025119
Peptides. 2014 Nov;61:114-21
pubmed: 25241629
Chem Rev. 2015 Feb 25;115(4):1760-846
pubmed: 25594509
J Pept Sci. 2023 Aug;29(8):e3482
pubmed: 36739581
Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W668-73
pubmed: 15215473
BMC Evol Biol. 2010 May 18;10:146
pubmed: 20482771
Anal Biochem. 2000 Dec 15;287(2):252-60
pubmed: 11112271
Protein J. 2004 Nov;23(8):501-8
pubmed: 15648972
Anal Biochem. 1986 May 15;155(1):155-67
pubmed: 3717552
Acc Chem Res. 2021 May 4;54(9):2196-2204
pubmed: 33844916
Antibiotics (Basel). 2020 Oct 20;9(10):
pubmed: 33092132
Peptides. 2009 May;30(5):888-92
pubmed: 19428765
Eur J Biochem. 2000 Jan;267(1):269-75
pubmed: 10601876
Nat Struct Biol. 1994 Jun;1(6):399-409
pubmed: 7664054

Auteurs

J Michael Conlon (JM)

Diabetes Research Centre, School of Biomedical Sciences, Ulster University, Coleraine, BT52 1SA, Northern Ireland, UK. jmconlon1@gmail.com.

Laure Guilhaudis (L)

Laboratoire COBRA (UMR 6014 & FR 3038), INSA de Rouen, CNRS, Université Rouen Normandie, 76000, Rouen, France.

Samir Attoub (S)

Department of Pharmacology and Therapeutics, College of Medicine and Health Sciences, United Arab Emirates University, 17666, Al Ain, United Arab Emirates.

Laurent Coquet (L)

CNRS UAR2026, HeRacLeS-PISSARO PBS UMR 6270, Université Rouen Normandie, 76000, Rouen, France.

Jérôme Leprince (J)

CNRS UAR2026, HeRacLeS-PISSARO PBS UMR 6270, Université Rouen Normandie, 76000, Rouen, France.
INSERM, Normandie Université, NorDiC UMR 1239, HeRacLeS, US 51, PRIMACEN, Université Rouen Normandie, 76000, Rouen, France.

Thierry Jouenne (T)

CNRS UAR2026, HeRacLeS-PISSARO PBS UMR 6270, Université Rouen Normandie, 76000, Rouen, France.

Milena Mechkarska (M)

Department of Life Sciences, Faculty of Science and Technology, The University of The West Indies, St. Augustine Campus, St. Augustine, Trinidad and Tobago.

Articles similaires

[Redispensing of expensive oral anticancer medicines: a practical application].

Lisanne N van Merendonk, Kübra Akgöl, Bastiaan Nuijen
1.00
Humans Antineoplastic Agents Administration, Oral Drug Costs Counterfeit Drugs

Smoking Cessation and Incident Cardiovascular Disease.

Jun Hwan Cho, Seung Yong Shin, Hoseob Kim et al.
1.00
Humans Male Smoking Cessation Cardiovascular Diseases Female
Humans United States Aged Cross-Sectional Studies Medicare Part C
1.00
Humans Yoga Low Back Pain Female Male

Classifications MeSH